Lineage for d2weia1 (2wei A:70-338)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984883Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries)
  8. 2984884Domain d2weia1: 2wei A:70-338 [206777]
    Other proteins in same PDB: d2weia2
    automated match to d2qkra_
    complexed with vgg

Details for d2weia1

PDB Entry: 2wei (more details), 1.65 Å

PDB Description: crystal structure of the kinase domain of cryptosporidium parvum calcium dependent protein kinase in complex with 3-mb-pp1
PDB Compounds: (A:) calmodulin-domain protein kinase 1, putative

SCOPe Domain Sequences for d2weia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2weia1 d.144.1.0 (A:70-338) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasaknkdtstilrevellkk
ldhpnimklfeiledsssfyivgelytggelfdeiikrkrfsehdaariikqvfsgitym
hkhnivhrdlkpenilleskekdcdikiidfglstcfqqntkmkdrigtayyiapevlrg
tydekcdvwsagvilyillsgtppfygkneydilkrvetgkyafdlpqwrtisddakdli
rkmltfhpslritatqclehpwiqkysse

SCOPe Domain Coordinates for d2weia1:

Click to download the PDB-style file with coordinates for d2weia1.
(The format of our PDB-style files is described here.)

Timeline for d2weia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2weia2