![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Cryptosporidium parvum [TaxId:353152] [196400] (5 PDB entries) |
![]() | Domain d2weia1: 2wei A:70-338 [206777] Other proteins in same PDB: d2weia2 automated match to d2qkra_ complexed with vgg |
PDB Entry: 2wei (more details), 1.65 Å
SCOPe Domain Sequences for d2weia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2weia1 d.144.1.0 (A:70-338) automated matches {Cryptosporidium parvum [TaxId: 353152]} gtfaerynivcmlgkgsfgevlkckdritqqeyavkvinkasaknkdtstilrevellkk ldhpnimklfeiledsssfyivgelytggelfdeiikrkrfsehdaariikqvfsgitym hkhnivhrdlkpenilleskekdcdikiidfglstcfqqntkmkdrigtayyiapevlrg tydekcdvwsagvilyillsgtppfygkneydilkrvetgkyafdlpqwrtisddakdli rkmltfhpslritatqclehpwiqkysse
Timeline for d2weia1: