Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries) |
Domain d2wdub2: 2wdu B:85-211 [206776] Other proteins in same PDB: d2wdua1, d2wdub1 automated match to d2f8fa1 complexed with br, dms, gds, gsh |
PDB Entry: 2wdu (more details), 1.62 Å
SCOPe Domain Sequences for d2wdub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wdub2 a.45.1.0 (B:85-211) automated matches {Fasciola hepatica [TaxId: 6192]} mgetdeeyylieriigecedlyrevytifrtpqgekeakikefkenngptllklvsesle ssggkhvagnritlgdlflfttlthvmetvpgfleqkfpklhefhkslptscsrlseylk kraktpf
Timeline for d2wdub2: