SCOPe 2.07: Domain d2wdub2: 2wdu B:85-211

Lineage for d2wdub2 (2wdu B:85-211)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries)

8. Domain d2wdub2: 2wdu B:85-211 [206776]
   Other proteins in same PDB: d2wdua1, d2wdub1
   automated match to d2f8fa1
   complexed with br, dms, gds, gsh

Details for d2wdub2

PDB Entry: 2wdu, 1.62 Å

PDB Description: fasciola hepatica sigma class gst

PDB Compounds: (B:) glutathione transferase sigma class

SCOPe Domain Sequences for d2wdub2:

Sequence; same for both SEQRES and ATOM records:

>d2wdub2 a.45.1.0 (B:85-211) automated matches {Fasciola hepatica [TaxId: 6192]}
mgetdeeyylieriigecedlyrevytifrtpqgekeakikefkenngptllklvsesle
ssggkhvagnritlgdlflfttlthvmetvpgfleqkfpklhefhkslptscsrlseylk
kraktpf

Timeline for d2wdub2:

• d2wdub2 first appeared in SCOPe 2.03
  
• d2wdub2 appears in SCOPe 2.06
  
• d2wdub2 appears in the current release, SCOPe 2.08