SCOPe 2.05: Domain d2wcza_: 2wcz A:

Lineage for d2wcza_ (2wcz A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.0: automated matches [191531] (1 protein)
   not a true family

6. Protein automated matches [190900] (2 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [225641] (2 PDB entries)

8. Domain d2wcza_: 2wcz A: [206771]
   automated match to d1ob8b_
   complexed with cl

Details for d2wcza_

PDB Entry: 2wcz, 1.65 Å

PDB Description: 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile

PDB Compounds: (A:) holliday junction resolvase

SCOPe Domain Sequences for d2wcza_:

Sequence; same for both SEQRES and ATOM records:

>d2wcza_ c.52.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
trferdllvelwkagfaairvagsgvspfpcpdivagngrtylaievkmrkelplylsad
eveqlvtfargfgaeayvalklprkkwrffpvqmlerteknfkidesvyplgleiaevag
kff

Timeline for d2wcza_:

• d2wcza_ first appeared in SCOPe 2.03
  
• d2wcza_ appears in SCOPe 2.04
  
• d2wcza_ appears in SCOPe 2.06
  
• d2wcza_ appears in the current release, SCOPe 2.08