Lineage for d2wcwd_ (2wcw D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882912Family c.52.1.0: automated matches [191531] (1 protein)
    not a true family
  6. 2882913Protein automated matches [190900] (3 species)
    not a true protein
  7. 2882914Species Archaeoglobus fulgidus [TaxId:2234] [225641] (2 PDB entries)
  8. 2882918Domain d2wcwd_: 2wcw D: [206769]
    automated match to d1ob8b_
    complexed with act, nh4

Details for d2wcwd_

PDB Entry: 2wcw (more details), 1.58 Å

PDB Description: 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile
PDB Compounds: (D:) hjc

SCOPe Domain Sequences for d2wcwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wcwd_ c.52.1.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
skgtrferdllvelwkagfaairvagagvspfpcpdivagngrtylaievkmrkelplyl
sadeveqlvtfargfgaeayvalklpraawrffpvqmlerteknfkidesvyplgleiae
vagkf

SCOPe Domain Coordinates for d2wcwd_:

Click to download the PDB-style file with coordinates for d2wcwd_.
(The format of our PDB-style files is described here.)

Timeline for d2wcwd_: