Lineage for d2wbib2 (2wbi B:266-424)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708584Species Human (Homo sapiens) [TaxId:9606] [225243] (4 PDB entries)
  8. 2708598Domain d2wbib2: 2wbi B:266-424 [206762]
    Other proteins in same PDB: d2wbia1, d2wbib1
    automated match to d1ukwa1
    complexed with fad, po4, unx

Details for d2wbib2

PDB Entry: 2wbi (more details), 2.8 Å

PDB Description: crystal structure of human acyl-coa dehydrogenase 11
PDB Compounds: (B:) acyl-coa dehydrogenase family member 11

SCOPe Domain Sequences for d2wbib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbib2 a.29.3.0 (B:266-424) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grgfeisqgrlgpgrihhcmrtvglaeralqimceratqriafkkklyahevvahwiaes
riaiekirlltlkaahsmdtlgsagakkeiamikvaapravskivdwaiqvcggagvsqd
yplanmyaitrvlrladgpdevhlsaiatmelrdqakrl

SCOPe Domain Coordinates for d2wbib2:

Click to download the PDB-style file with coordinates for d2wbib2.
(The format of our PDB-style files is described here.)

Timeline for d2wbib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wbib1