SCOPe 2.08: Domain d2wbia1: 2wbi A:22-265

Lineage for d2wbia1 (2wbi A:22-265)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225242] (2 PDB entries)

8. Domain d2wbia1: 2wbi A:22-265 [206759]
   Other proteins in same PDB: d2wbia2, d2wbib2
   automated match to d1ukwa2
   complexed with fad, po4, unx

Details for d2wbia1

PDB Entry: 2wbi, 2.8 Å

PDB Description: crystal structure of human acyl-coa dehydrogenase 11

PDB Compounds: (A:) acyl-coa dehydrogenase family member 11

SCOPe Domain Sequences for d2wbia1:

Sequence, based on SEQRES records:

>d2wbia1 e.6.1.0 (A:22-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqtrkgqevlikvkhfmkqhilpaekevtefyvqnensvdkwgkplvidklkemakvegl
wnlflpavsglshvdyaliaeetgkcffapdvfncqapdtgnmevlhlygseeqkkqwle
pllqgnitscfcmtepdvassdatniecsiqrdedsyvingkkwwssgagnpkckiaivl
grtqntslsrhkqhsmilvpmntpgvkiirplsvfgytdnfhgghfeihfnqvrvpatnl
ilge

Sequence, based on observed residues (ATOM records):

>d2wbia1 e.6.1.0 (A:22-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqtrkgqevlikvkhfmkqhilpaekevtekwgkplvidklkemakveglwnlflpavsg
lshvdyaliaeetgkcffapdvfncqapdtgnmevlhlygseeqkkqwlepllqgnitsc
fcmtepdvassdatniecsiqrdedsyvingkkwwssgagnpkckiaivlgrtqntslsr
hkqhsmilvpmntpgvkiirplsvfgytdnfhgghfeihfnqvrvpatnlilge

Timeline for d2wbia1:

• d2wbia1 first appeared in SCOPe 2.03
  
• d2wbia1 appears in SCOPe 2.07