SCOPe 2.06: Domain d2wb9b2: 2wb9 B:85-211

Lineage for d2wb9b2 (2wb9 B:85-211)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries)

8. Domain d2wb9b2: 2wb9 B:85-211 [206758]
   Other proteins in same PDB: d2wb9a1, d2wb9b1
   automated match to d2f8fa1
   complexed with br, cys, gsh

Details for d2wb9b2

PDB Entry: 2wb9, 1.59 Å

PDB Description: Fasciola hepatica sigma class GST

PDB Compounds: (B:) glutathione transferase sigma class

SCOPe Domain Sequences for d2wb9b2:

Sequence; same for both SEQRES and ATOM records:

>d2wb9b2 a.45.1.0 (B:85-211) automated matches {Fasciola hepatica [TaxId: 6192]}
mgetdeeyylieriigecedlyrevytifrtpqgekeakikefkenngptllklvsesle
ssggkhvagnritlgdlflfttlthvmetvpgfleqkfpklhefhkslptscsrlseylk
kraktpf

Timeline for d2wb9b2:

• d2wb9b2 first appeared in SCOPe 2.03
  
• d2wb9b2 appears in SCOPe 2.05
  
• d2wb9b2 appears in SCOPe 2.07
  
• d2wb9b2 appears in the current release, SCOPe 2.08