Lineage for d2wb9b2 (2wb9 B:85-211)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713932Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries)
  8. 2713934Domain d2wb9b2: 2wb9 B:85-211 [206758]
    Other proteins in same PDB: d2wb9a1, d2wb9b1
    automated match to d2f8fa1
    complexed with br, cys, gsh

Details for d2wb9b2

PDB Entry: 2wb9 (more details), 1.59 Å

PDB Description: Fasciola hepatica sigma class GST
PDB Compounds: (B:) glutathione transferase sigma class

SCOPe Domain Sequences for d2wb9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wb9b2 a.45.1.0 (B:85-211) automated matches {Fasciola hepatica [TaxId: 6192]}
mgetdeeyylieriigecedlyrevytifrtpqgekeakikefkenngptllklvsesle
ssggkhvagnritlgdlflfttlthvmetvpgfleqkfpklhefhkslptscsrlseylk
kraktpf

SCOPe Domain Coordinates for d2wb9b2:

Click to download the PDB-style file with coordinates for d2wb9b2.
(The format of our PDB-style files is described here.)

Timeline for d2wb9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wb9b1