![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Fasciola hepatica [TaxId:6192] [225860] (3 PDB entries) |
![]() | Domain d2wb9b2: 2wb9 B:85-211 [206758] Other proteins in same PDB: d2wb9a1, d2wb9b1 automated match to d2f8fa1 complexed with br, cys, gsh |
PDB Entry: 2wb9 (more details), 1.59 Å
SCOPe Domain Sequences for d2wb9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wb9b2 a.45.1.0 (B:85-211) automated matches {Fasciola hepatica [TaxId: 6192]} mgetdeeyylieriigecedlyrevytifrtpqgekeakikefkenngptllklvsesle ssggkhvagnritlgdlflfttlthvmetvpgfleqkfpklhefhkslptscsrlseylk kraktpf
Timeline for d2wb9b2: