Lineage for d2wb9b1 (2wb9 B:2-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879471Species Fasciola hepatica [TaxId:6192] [188507] (4 PDB entries)
  8. 2879473Domain d2wb9b1: 2wb9 B:2-84 [206757]
    Other proteins in same PDB: d2wb9a2, d2wb9b2
    automated match to d2f8fa2
    complexed with br, cys, gsh

Details for d2wb9b1

PDB Entry: 2wb9 (more details), 1.59 Å

PDB Description: Fasciola hepatica sigma class GST
PDB Compounds: (B:) glutathione transferase sigma class

SCOPe Domain Sequences for d2wb9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wb9b1 c.47.1.0 (B:2-84) automated matches {Fasciola hepatica [TaxId: 6192]}
dkqhfklwyfqfrgraepirllltcagvkfedyqftmdqwptikptlpggrvplldvtgp
dgklrryqesmaiarllarqfkm

SCOPe Domain Coordinates for d2wb9b1:

Click to download the PDB-style file with coordinates for d2wb9b1.
(The format of our PDB-style files is described here.)

Timeline for d2wb9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wb9b2