SCOPe 2.08: Domain d2wb9a1: 2wb9 A:2-84

Lineage for d2wb9a1 (2wb9 A:2-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Fasciola hepatica [TaxId:6192] [188507] (4 PDB entries)

8. Domain d2wb9a1: 2wb9 A:2-84 [206755]
   Other proteins in same PDB: d2wb9a2, d2wb9b2
   automated match to d2f8fa2
   complexed with br, cys, gsh

Details for d2wb9a1

PDB Entry: 2wb9, 1.59 Å

PDB Description: Fasciola hepatica sigma class GST

PDB Compounds: (A:) glutathione transferase sigma class

SCOPe Domain Sequences for d2wb9a1:

Sequence; same for both SEQRES and ATOM records:

>d2wb9a1 c.47.1.0 (A:2-84) automated matches {Fasciola hepatica [TaxId: 6192]}
dkqhfklwyfqfrgraepirllltcagvkfedyqftmdqwptikptlpggrvplldvtgp
dgklrryqesmaiarllarqfkm

Timeline for d2wb9a1:

• d2wb9a1 first appeared in SCOPe 2.03
  
• d2wb9a1 appears in SCOPe 2.07