Lineage for d2wahb2 (2wah B:340-445)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294609Domain d2wahb2: 2wah B:340-445 [206744]
    automated match to d2ql1a2

Details for d2wahb2

PDB Entry: 2wah (more details), 2.51 Å

PDB Description: crystal structure of an igg1 fc glycoform (man9glcnac2)
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d2wahb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wahb2 b.1.1.2 (B:340-445) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykatppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOPe Domain Coordinates for d2wahb2:

Click to download the PDB-style file with coordinates for d2wahb2.
(The format of our PDB-style files is described here.)

Timeline for d2wahb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wahb1