| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
| Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
| Protein automated matches [226856] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224978] (13 PDB entries) |
| Domain d2wa7a2: 2wa7 A:137-240 [206740] automated match to d1sh5a2 complexed with cac, co3; mutant |
PDB Entry: 2wa7 (more details), 1.85 Å
SCOPe Domain Sequences for d2wa7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wa7a2 a.40.1.0 (A:137-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvd
nareavqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpka
Timeline for d2wa7a2: