SCOPe 2.07: Domain d2wa6a2: 2wa6 A:137-239

Lineage for d2wa6a2 (2wa6 A:137-239)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (30 PDB entries)

8. Domain d2wa6a2: 2wa6 A:137-239 [206738]
   automated match to d1sh5a2
   complexed with co3; mutant

Details for d2wa6a2

PDB Entry: 2wa6, 1.95 Å

PDB Description: structure of the w148r mutant of human filamin b actin binding domain at 1.95 angstrom resolution

PDB Compounds: (A:) Filamin-B

SCOPe Domain Sequences for d2wa6a2:

Sequence; same for both SEQRES and ATOM records:

>d2wa6a2 a.40.1.0 (A:137-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkqtpkqrllgriqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvd
nareamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpk

Timeline for d2wa6a2:

• d2wa6a2 first appeared in SCOPe 2.03
  
• d2wa6a2 appears in SCOPe 2.06