Lineage for d2wa6a2 (2wa6 A:137-239)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712108Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2712140Domain d2wa6a2: 2wa6 A:137-239 [206738]
    automated match to d1sh5a2
    complexed with co3; mutant

Details for d2wa6a2

PDB Entry: 2wa6 (more details), 1.95 Å

PDB Description: structure of the w148r mutant of human filamin b actin binding domain at 1.95 angstrom resolution
PDB Compounds: (A:) Filamin-B

SCOPe Domain Sequences for d2wa6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wa6a2 a.40.1.0 (A:137-239) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkqtpkqrllgriqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswdpqkpvd
nareamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqfpk

SCOPe Domain Coordinates for d2wa6a2:

Click to download the PDB-style file with coordinates for d2wa6a2.
(The format of our PDB-style files is described here.)

Timeline for d2wa6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wa6a1