Lineage for d2w9qa_ (2w9q A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935931Species Potato (Solanum tuberosum) [TaxId:4113] [225839] (3 PDB entries)
  8. 2935949Domain d2w9qa_: 2w9q A: [206734]
    automated match to d3imab_

Details for d2w9qa_

PDB Entry: 2w9q (more details), 2.5 Å

PDB Description: crystal structure of potato multicystatin-p212121
PDB Compounds: (A:) multicystatin

SCOPe Domain Sequences for d2w9qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9qa_ d.17.1.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
givnvpnpnntkfqelarfaiqdynkkqnahlefvenlnvkeqvvagimyyitlaatdda
gkkkiykakiwvkewedfkkvvefklv

SCOPe Domain Coordinates for d2w9qa_:

Click to download the PDB-style file with coordinates for d2w9qa_.
(The format of our PDB-style files is described here.)

Timeline for d2w9qa_: