![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
![]() | Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
![]() | Protein automated matches [190558] (13 species) not a true protein |
![]() | Species Potato (Solanum tuberosum) [TaxId:4113] [225839] (3 PDB entries) |
![]() | Domain d2w9pj_: 2w9p J: [206729] automated match to d3imab_ |
PDB Entry: 2w9p (more details), 2.7 Å
SCOPe Domain Sequences for d2w9pj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w9pj_ d.17.1.0 (J:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]} givnvpnpnntkfqelarfaiqdynkkqnahlefvenlnvkeqvvagimyyitlaatdda gkkkiykakiwvkewedfkkvvefklv
Timeline for d2w9pj_: