Lineage for d2w9ph_ (2w9p H:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1404617Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1404755Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 1404756Protein automated matches [190558] (6 species)
    not a true protein
  7. 1404769Species Potato (Solanum tuberosum) [TaxId:4113] [225839] (2 PDB entries)
  8. 1404778Domain d2w9ph_: 2w9p H: [206727]
    automated match to d3imab_

Details for d2w9ph_

PDB Entry: 2w9p (more details), 2.7 Å

PDB Description: crystal structure of potato multicystatin
PDB Compounds: (H:) multicystatin

SCOPe Domain Sequences for d2w9ph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w9ph_ d.17.1.0 (H:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
givnvpnpnntkfqelarfaiqdynkkqnahlefvenlnvkeqvvagimyyitlaatdda
gkkkiykakiwvkewedfkkvvefklv

SCOPe Domain Coordinates for d2w9ph_:

Click to download the PDB-style file with coordinates for d2w9ph_.
(The format of our PDB-style files is described here.)

Timeline for d2w9ph_: