Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries) Uniprot P30685 25-300 Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor Uniprot P30481 25-300 Uniprot P01892 25-298 Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor |
Domain d1duzd1: 1duz D:182-275 [20672] Other proteins in same PDB: d1duza2, d1duzb_, d1duzd2, d1duze_ |
PDB Entry: 1duz (more details), 1.8 Å
SCOP Domain Sequences for d1duzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1duzd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1duzd1:
View in 3D Domains from other chains: (mouse over for more information) d1duza1, d1duza2, d1duzb_, d1duze_ |