SCOP 1.65: Domain d1duzd1: 1duz D:182-275

Lineage for d1duzd1 (1duz D:182-275)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (56 PDB entries)

8. Domain d1duzd1: 1duz D:182-275 [20672]
   Other proteins in same PDB: d1duza2, d1duzb_, d1duzd2, d1duze_

Details for d1duzd1

PDB Entry: 1duz, 1.8 Å

PDB Description: human class i histocompatibility antigen (hla-a 0201) in complex with a nonameric peptide from htlv-1 tax protein

SCOP Domain Sequences for d1duzd1:

Sequence; same for both SEQRES and ATOM records:

>d1duzd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1duzd1:

• d1duzd1 first appeared (with stable ids) in SCOP 1.55
  
• d1duzd1 appears in SCOP 1.63
  
• d1duzd1 appears in SCOP 1.67
  
• d1duzd1 appears in the current release, SCOPe 2.07