SCOPe 2.08: Domain d2w9dl1: 2w9d L:1-106

Lineage for d2w9dl1 (2w9d L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2w9dl1: 2w9d L:1-106 [206718]
   Other proteins in same PDB: d2w9dh_, d2w9dl2
   automated match to d2fatl1
   complexed with ca

Details for d2w9dl1

PDB Entry: 2w9d, 1.57 Å

PDB Description: structure of fab fragment of the icsm 18 - anti-prp therapeutic antibody at 1.57 a resolution.

PDB Compounds: (L:) icsm 18-anti-prp therapeutic fab light chain

SCOPe Domain Sequences for d2w9dl1:

Sequence; same for both SEQRES and ATOM records:

>d2w9dl1 b.1.1.0 (L:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyfchqwrsnpytfgggtkleik

Timeline for d2w9dl1:

• d2w9dl1 first appeared in SCOPe 2.03
  
• d2w9dl1 appears in SCOPe 2.07