Lineage for d2w90b2 (2w90 B:176-469)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276508Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1276509Protein automated matches [226851] (23 species)
    not a true protein
  7. 1276535Species Geobacillus stearothermophilus [TaxId:1422] [225640] (2 PDB entries)
  8. 1276537Domain d2w90b2: 2w90 B:176-469 [206717]
    Other proteins in same PDB: d2w90a1, d2w90b1
    automated match to d1pgja1
    complexed with 6pg, so4, trs

Details for d2w90b2

PDB Entry: 2w90 (more details), 2.2 Å

PDB Description: Geobacillus stearothermophilus 6-phosphogluconate with bound 6- phosphogluconate
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2w90b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w90b2 a.100.1.0 (B:176-469) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
gaghyvkmvhngieygdmqliaeayfllkhvlgmdaaelhevfadwnkgelnsylieita
diftkideetgkplvdvildkagqkgtgkwtsqnaldlgvplpiitesvfarflsamkde
rvkaskvlagpavkpfegdrahfieavrralymskicsyaqgfaqmkaaseeynwnlryg
diamifrggciiraqflqkikeaydrdpalsnllldsyfkdiveryqdalreivataamr
gipvpgsasalayydsyrtavlpanliqaqrdyfgahtyervdkegifhtewlk

SCOPe Domain Coordinates for d2w90b2:

Click to download the PDB-style file with coordinates for d2w90b2.
(The format of our PDB-style files is described here.)

Timeline for d2w90b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w90b1