SCOPe 2.08: Domain d2w90b2: 2w90 B:176-469

Lineage for d2w90b2 (2w90 B:176-469)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [225640] (2 PDB entries)

8. Domain d2w90b2: 2w90 B:176-469 [206717]
   Other proteins in same PDB: d2w90a1, d2w90b1
   automated match to d1pgja1
   complexed with 6pg, so4, trs

Details for d2w90b2

PDB Entry: 2w90, 2.2 Å

PDB Description: Geobacillus stearothermophilus 6-phosphogluconate with bound 6- phosphogluconate

PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2w90b2:

Sequence; same for both SEQRES and ATOM records:

>d2w90b2 a.100.1.0 (B:176-469) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
gaghyvkmvhngieygdmqliaeayfllkhvlgmdaaelhevfadwnkgelnsylieita
diftkideetgkplvdvildkagqkgtgkwtsqnaldlgvplpiitesvfarflsamkde
rvkaskvlagpavkpfegdrahfieavrralymskicsyaqgfaqmkaaseeynwnlryg
diamifrggciiraqflqkikeaydrdpalsnllldsyfkdiveryqdalreivataamr
gipvpgsasalayydsyrtavlpanliqaqrdyfgahtyervdkegifhtewlk

Timeline for d2w90b2:

• d2w90b2 first appeared in SCOPe 2.03
  
• d2w90b2 appears in SCOPe 2.07