SCOPe 2.08: Domain d2w90a1: 2w90 A:0-175

Lineage for d2w90a1 (2w90 A:0-175)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [225639] (6 PDB entries)

8. Domain d2w90a1: 2w90 A:0-175 [206714]
   Other proteins in same PDB: d2w90a2, d2w90b2
   automated match to d1pgja2
   complexed with 6pg, so4, trs

Details for d2w90a1

PDB Entry: 2w90, 2.2 Å

PDB Description: Geobacillus stearothermophilus 6-phosphogluconate with bound 6- phosphogluconate

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2w90a1:

Sequence; same for both SEQRES and ATOM records:

>d2w90a1 c.2.1.0 (A:0-175) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hmakhqigviglavmgknlalnieskgysvavynrlrektdeflqeakgknivgtysiee
fvnalekprkillmvkagaptdatieqlkphlekgdividggntyfkdtqrrnkelaelg
ihfigtgvsggeegalkgpsimpggqkeahelvrpifeaiaakvdgepcttyigpd

Timeline for d2w90a1:

• d2w90a1 first appeared in SCOPe 2.03
  
• d2w90a1 appears in SCOPe 2.07