Lineage for d2w8zb1 (2w8z B:2-175)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831207Species Geobacillus stearothermophilus [TaxId:1422] [225639] (2 PDB entries)
  8. 1831211Domain d2w8zb1: 2w8z B:2-175 [206712]
    Other proteins in same PDB: d2w8za2, d2w8zb2
    automated match to d1pgja2
    complexed with 6pg, so4, trs

Details for d2w8zb1

PDB Entry: 2w8z (more details), 2.3 Å

PDB Description: geobacillus stearothermophilus 6-phosphogluconate dehydrogenase with bound 6- phosphogluconate
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2w8zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8zb1 c.2.1.0 (B:2-175) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
akhqigviglavmgknlalnieskgysvavynrlrektdeflqeakgknivgtysieefv
nalekprkillmvkagaptdatieqlkphlekgdividggntyfkdtqrrnkelaelgih
figtgvsggeegalkgpsimpggqkeahelvrpifeaiaakvdgepcttyigpd

SCOPe Domain Coordinates for d2w8zb1:

Click to download the PDB-style file with coordinates for d2w8zb1.
(The format of our PDB-style files is described here.)

Timeline for d2w8zb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w8zb2