| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Geobacillus stearothermophilus [TaxId:1422] [225640] (2 PDB entries) |
| Domain d2w8za2: 2w8z A:176-469 [206711] Other proteins in same PDB: d2w8za1, d2w8zb1 automated match to d1pgja1 complexed with 6pg, so4, trs |
PDB Entry: 2w8z (more details), 2.3 Å
SCOPe Domain Sequences for d2w8za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w8za2 a.100.1.0 (A:176-469) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
gaghyvkmvhngieygdmqliaeayfllkhvlgmdaaelhevfadwnkgelnsylieita
diftkideetgkplvdvildkagqkgtgkwtsqnaldlgvplpiitesvfarflsamkde
rvkaskvlagpavkpfegdrahfieavrralymskicsyaqgfaqmkaaseeynwnlryg
diamifrggciiraqflqkikeaydrdpalsnllldsyfkdiveryqdalreivataamr
gipvpgsasalayydsyrtavlpanliqaqrdyfgahtyervdkegifhtewlk
Timeline for d2w8za2: