| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Geobacillus stearothermophilus [TaxId:1422] [225639] (6 PDB entries) |
| Domain d2w8za1: 2w8z A:2-175 [206710] Other proteins in same PDB: d2w8za2, d2w8zb2 automated match to d1pgja2 complexed with 6pg, so4, trs |
PDB Entry: 2w8z (more details), 2.3 Å
SCOPe Domain Sequences for d2w8za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w8za1 c.2.1.0 (A:2-175) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
akhqigviglavmgknlalnieskgysvavynrlrektdeflqeakgknivgtysieefv
nalekprkillmvkagaptdatieqlkphlekgdividggntyfkdtqrrnkelaelgih
figtgvsggeegalkgpsimpggqkeahelvrpifeaiaakvdgepcttyigpd
Timeline for d2w8za1: