Lineage for d2w8na_ (2w8n A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516430Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2516431Protein automated matches [190683] (59 species)
    not a true protein
  7. 2516624Species Human (Homo sapiens) [TaxId:9606] [225691] (37 PDB entries)
  8. 2516641Domain d2w8na_: 2w8n A: [206709]
    automated match to d1euha_
    complexed with so4

Details for d2w8na_

PDB Entry: 2w8n (more details), 2 Å

PDB Description: The crystal structure of the oxidized form of human SSADH
PDB Compounds: (A:) succinate-semialdehyde dehydrogenase, mitochondrial

SCOPe Domain Sequences for d2w8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8na_ c.82.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aallrtdsfvggrwlpaaatfpvqdpasgaalgmvadcgvrearaavraayeafcrwrev
sakerssllrkwynlmiqnkddlariitaesgkplkeahgeilysafflewfseearrvy
gdiihtpakdrralvlkqpigvaavitpwnfpsamitrkvgaalaagctvvvkpaedtpf
salalaelasqagipsgvynvipcsrknakevgeaictdplvskisftgstttgkillhh
aansvkrvsmelgglapfivfdsanvdqavagamaskfrntgqtcvcsnqflvqrgihda
fvkafaeamkknlrvgngfeegttqgplinekavekvekqvndavskgatvvtggkrhql
gknffeptllcnvtqdmlctheetfgplapvikfdteeeaiaianaadvglagyfysqdp
aqiwrvaeqlevgmvgvneglissvecpfggvkqsglgregskygideylelkyvcyggl

SCOPe Domain Coordinates for d2w8na_:

Click to download the PDB-style file with coordinates for d2w8na_.
(The format of our PDB-style files is described here.)

Timeline for d2w8na_: