Lineage for d2w83b_ (2w83 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868241Domain d2w83b_: 2w83 B: [206707]
    automated match to d1upte_
    complexed with dio, gol, gtp, mg

Details for d2w83b_

PDB Entry: 2w83 (more details), 1.93 Å

PDB Description: crystal structure of the arf6 gtpase in complex with a specific effector, jip4
PDB Compounds: (B:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2w83b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w83b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
memrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsn

SCOPe Domain Coordinates for d2w83b_:

Click to download the PDB-style file with coordinates for d2w83b_.
(The format of our PDB-style files is described here.)

Timeline for d2w83b_: