Lineage for d2w7wb1 (2w7w B:2-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690369Species Aliivibrio salmonicida [TaxId:316275] [225612] (1 PDB entry)
  8. 2690371Domain d2w7wb1: 2w7w B:2-83 [206704]
    Other proteins in same PDB: d2w7wa2, d2w7wb2
    automated match to d1isca1
    complexed with fe

Details for d2w7wb1

PDB Entry: 2w7w (more details), 1.7 Å

PDB Description: the crystal structure of iron superoxide dismutase from aliivibrio salmonicida.
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2w7wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w7wb1 a.2.11.0 (B:2-83) automated matches {Aliivibrio salmonicida [TaxId: 316275]}
sfelpalpfakdalephisaetldyhhgkhhntyvvklnglipgtefegktleeiiktst
ggvfnnaaqiwnhtfywnclap

SCOPe Domain Coordinates for d2w7wb1:

Click to download the PDB-style file with coordinates for d2w7wb1.
(The format of our PDB-style files is described here.)

Timeline for d2w7wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w7wb2