Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (37 species) not a true protein |
Species Aliivibrio salmonicida [TaxId:316275] [225613] (1 PDB entry) |
Domain d2w7wa2: 2w7w A:84-194 [206703] Other proteins in same PDB: d2w7wa1, d2w7wb1 automated match to d2nyba2 complexed with fe |
PDB Entry: 2w7w (more details), 1.7 Å
SCOPe Domain Sequences for d2w7wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w7wa2 d.44.1.0 (A:84-194) automated matches {Aliivibrio salmonicida [TaxId: 316275]} naggqptgavaaaidaafgsfeefkakftdsainnfgsswtwlvknadgslaivntsnaa tpltdegvtplltvdlwehayyidfrnvrpdymgafwslvnwsfveenlak
Timeline for d2w7wa2: