Lineage for d2w7wa2 (2w7w A:84-194)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553218Species Aliivibrio salmonicida [TaxId:316275] [225613] (1 PDB entry)
  8. 2553219Domain d2w7wa2: 2w7w A:84-194 [206703]
    Other proteins in same PDB: d2w7wa1, d2w7wb1
    automated match to d2nyba2
    complexed with fe

Details for d2w7wa2

PDB Entry: 2w7w (more details), 1.7 Å

PDB Description: the crystal structure of iron superoxide dismutase from aliivibrio salmonicida.
PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2w7wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w7wa2 d.44.1.0 (A:84-194) automated matches {Aliivibrio salmonicida [TaxId: 316275]}
naggqptgavaaaidaafgsfeefkakftdsainnfgsswtwlvknadgslaivntsnaa
tpltdegvtplltvdlwehayyidfrnvrpdymgafwslvnwsfveenlak

SCOPe Domain Coordinates for d2w7wa2:

Click to download the PDB-style file with coordinates for d2w7wa2.
(The format of our PDB-style files is described here.)

Timeline for d2w7wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2w7wa1