SCOPe 2.03: Domain d2w7wa2: 2w7w A:84-194

Lineage for d2w7wa2 (2w7w A:84-194)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (25 species)
   not a true protein

7. Species Aliivibrio salmonicida [TaxId:316275] [225613] (1 PDB entry)

8. Domain d2w7wa2: 2w7w A:84-194 [206703]
   Other proteins in same PDB: d2w7wa1, d2w7wb1
   automated match to d2nyba2
   complexed with fe

Details for d2w7wa2

PDB Entry: 2w7w, 1.7 Å

PDB Description: the crystal structure of iron superoxide dismutase from aliivibrio salmonicida.

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2w7wa2:

Sequence; same for both SEQRES and ATOM records:

>d2w7wa2 d.44.1.0 (A:84-194) automated matches {Aliivibrio salmonicida [TaxId: 316275]}
naggqptgavaaaidaafgsfeefkakftdsainnfgsswtwlvknadgslaivntsnaa
tpltdegvtplltvdlwehayyidfrnvrpdymgafwslvnwsfveenlak

Timeline for d2w7wa2:

• d2w7wa2 is new in SCOPe 2.03-stable
  
• d2w7wa2 appears in SCOPe 2.04
  
• d2w7wa2 appears in the current release, SCOPe 2.08