Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (15 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [193276] (6 PDB entries) |
Domain d2w7ud_: 2w7u D: [206701] automated match to d3ufab_ |
PDB Entry: 2w7u (more details), 2.43 Å
SCOPe Domain Sequences for d2w7ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w7ud_ b.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]} eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek nfgvyftpqlkefiqnniek
Timeline for d2w7ud_: