Lineage for d2w7ud_ (2w7u D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1320532Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1320533Protein automated matches [190438] (15 species)
    not a true protein
  7. 1320624Species Staphylococcus aureus [TaxId:93061] [193276] (6 PDB entries)
  8. 1320640Domain d2w7ud_: 2w7u D: [206701]
    automated match to d3ufab_

Details for d2w7ud_

PDB Entry: 2w7u (more details), 2.43 Å

PDB Description: spla serine protease of staphylococcus aureus (2.4a)
PDB Compounds: (D:) serine protease spla

SCOPe Domain Sequences for d2w7ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w7ud_ b.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]}
eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
nfgvyftpqlkefiqnniek

SCOPe Domain Coordinates for d2w7ud_:

Click to download the PDB-style file with coordinates for d2w7ud_.
(The format of our PDB-style files is described here.)

Timeline for d2w7ud_: