Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries) |
Domain d1duza1: 1duz A:182-275 [20670] Other proteins in same PDB: d1duza2, d1duzb_, d1duzd2, d1duze_ |
PDB Entry: 1duz (more details), 1.8 Å
SCOP Domain Sequences for d1duza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1duza1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1duza1:
View in 3D Domains from other chains: (mouse over for more information) d1duzb_, d1duzd1, d1duzd2, d1duze_ |