Lineage for d2w7sd_ (2w7s D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058338Species Staphylococcus aureus [TaxId:93061] [193276] (6 PDB entries)
  8. 2058347Domain d2w7sd_: 2w7s D: [206697]
    automated match to d3ufab_

Details for d2w7sd_

PDB Entry: 2w7s (more details), 1.8 Å

PDB Description: spla serine protease of staphylococcus aureus (1.8a)
PDB Compounds: (D:) serine protease spla

SCOPe Domain Sequences for d2w7sd_:

Sequence, based on SEQRES records: (download)

>d2w7sd_ b.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]}
eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk
gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk
gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek
nfgvyftpqlkefiqnniek

Sequence, based on observed residues (ATOM records): (download)

>d2w7sd_ b.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]}
eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiandifknrvsahhsgggnyd
vkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypkgaqtky
kmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdeseknfgvyf
tpqlkefiqnniek

SCOPe Domain Coordinates for d2w7sd_:

Click to download the PDB-style file with coordinates for d2w7sd_.
(The format of our PDB-style files is described here.)

Timeline for d2w7sd_: