Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [193276] (6 PDB entries) |
Domain d2w7sc_: 2w7s C: [206696] automated match to d3ufab_ |
PDB Entry: 2w7s (more details), 1.8 Å
SCOPe Domain Sequences for d2w7sc_:
Sequence, based on SEQRES records: (download)
>d2w7sc_ b.47.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]} eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek nfgvyftpqlkefiqnniek
>d2w7sc_ b.47.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93061]} eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaknrvsahhsskgggnydvk diveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypkgaqtkykm festgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdeseknfgvyftp qlkefiqnniek
Timeline for d2w7sc_: