Lineage for d2w71c2 (2w71 C:115-330)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1432998Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 1433005Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1433008Species Escherichia coli [TaxId:562] [56069] (19 PDB entries)
  8. 1433022Domain d2w71c2: 2w71 C:115-330 [206688]
    Other proteins in same PDB: d2w71a1, d2w71a3, d2w71c1, d2w71c3
    automated match to d1dv1b3
    complexed with cl, l23

Details for d2w71c2

PDB Entry: 2w71 (more details), 1.99 Å

PDB Description: Crystal structure of Biotin carboxylase from E. coli in complex with the imidazole-pyrimidine inhibitor
PDB Compounds: (C:) biotin carboxylase

SCOPe Domain Sequences for d2w71c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w71c2 d.142.1.2 (C:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2w71c2:

Click to download the PDB-style file with coordinates for d2w71c2.
(The format of our PDB-style files is described here.)

Timeline for d2w71c2: