SCOPe 2.08: Domain d2w71a2: 2w71 A:115-330

Lineage for d2w71a2 (2w71 A:115-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)

6. Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)

8. Domain d2w71a2: 2w71 A:115-330 [206685]
   Other proteins in same PDB: d2w71a1, d2w71a3, d2w71c1, d2w71c3
   automated match to d1dv1b3
   complexed with cl, l23

Details for d2w71a2

PDB Entry: 2w71, 1.99 Å

PDB Description: Crystal structure of Biotin carboxylase from E. coli in complex with the imidazole-pyrimidine inhibitor

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2w71a2:

Sequence; same for both SEQRES and ATOM records:

>d2w71a2 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Timeline for d2w71a2:

• d2w71a2 first appeared in SCOPe 2.03
  
• d2w71a2 appears in SCOPe 2.07