Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
Protein Biotin carboxylase (BC), domain 2 [56068] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [56069] (24 PDB entries) |
Domain d2w70b2: 2w70 B:115-330 [206682] Other proteins in same PDB: d2w70a1, d2w70a3, d2w70b1, d2w70b3 automated match to d1dv1a3 complexed with cl, l22 |
PDB Entry: 2w70 (more details), 1.77 Å
SCOPe Domain Sequences for d2w70b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w70b2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d2w70b2: