Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [48947] (1 PDB entry) |
Domain d1hlaa1: 1hla A:182-270 [20668] Other proteins in same PDB: d1hlaa2 |
PDB Entry: 1hla (more details), 3.5 Å
SCOP Domain Sequences for d1hlaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hlaa1 b.1.1.2 (A:182-270) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpl
Timeline for d1hlaa1: