Lineage for d1hlaa1 (1hla A:182-270)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 52933Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [48947] (1 PDB entry)
  8. 52934Domain d1hlaa1: 1hla A:182-270 [20668]
    Other proteins in same PDB: d1hlaa2

Details for d1hlaa1

PDB Entry: 1hla (more details), 3.5 Å

PDB Description: structure of the human class i histocompatibility antigen, hla-a2

SCOP Domain Sequences for d1hlaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlaa1 b.1.1.2 (A:182-270) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpl

SCOP Domain Coordinates for d1hlaa1:

Click to download the PDB-style file with coordinates for d1hlaa1.
(The format of our PDB-style files is described here.)

Timeline for d1hlaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hlam1