Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [51249] (24 PDB entries) |
Domain d2w6zb3: 2w6z B:331-446 [206677] Other proteins in same PDB: d2w6za1, d2w6za2, d2w6zb1, d2w6zb2 automated match to d1dv1a1 complexed with cl, l21 |
PDB Entry: 2w6z (more details), 1.9 Å
SCOPe Domain Sequences for d2w6zb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w6zb3 b.84.2.1 (B:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl
Timeline for d2w6zb3: