Lineage for d2w6qb2 (2w6q B:115-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928459Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 1928466Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1928469Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 1928488Domain d2w6qb2: 2w6q B:115-330 [206670]
    Other proteins in same PDB: d2w6qa1, d2w6qa3, d2w6qb1, d2w6qb3
    automated match to d1dv1a3
    complexed with cl, oa5

Details for d2w6qb2

PDB Entry: 2w6q (more details), 2.05 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with the triazine-2,4-diamine fragment
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2w6qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w6qb2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2w6qb2:

Click to download the PDB-style file with coordinates for d2w6qb2.
(The format of our PDB-style files is described here.)

Timeline for d2w6qb2: