Lineage for d1frtb_ (1frt B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106639Species Norway rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)
  8. 1106648Domain d1frtb_: 1frt B: [20666]
    Other proteins in same PDB: d1frta1, d1frta2, d1frtc1, d1frtc2
    complexed with nag

Details for d1frtb_

PDB Entry: 1frt (more details), 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc
PDB Compounds: (B:) beta 2-microglobulin

SCOPe Domain Sequences for d1frtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frtb_ b.1.1.2 (B:) beta2-microglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOPe Domain Coordinates for d1frtb_:

Click to download the PDB-style file with coordinates for d1frtb_.
(The format of our PDB-style files is described here.)

Timeline for d1frtb_: