SCOP 1.59: Domain d1frtb1: 1frt B:

Lineage for d1frtb1 (1frt B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)

8. Domain d1frtb1: 1frt B: [20666]
   Other proteins in same PDB: d1frta2, d1frtc1, d1frtc2

Details for d1frtb1

PDB Entry: 1frt, 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc

SCOP Domain Sequences for d1frtb1:

Sequence; same for both SEQRES and ATOM records:

>d1frtb1 b.1.1.2 (B:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

Timeline for d1frtb1:

• d1frtb1 first appeared (with stable ids) in SCOP 1.55
  
• d1frtb1 appears in SCOP 1.57
  
• d1frtb1 appears in SCOP 1.61
  
• d1frtb1 appears in the current release, SCOPe 2.08, called d1frtb_