Lineage for d1frtb1 (1frt B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8450Protein Fc (IgG) receptor, alpha-3 domain and beta subunit [48943] (1 species)
  7. 8451Species Rat (Rattus norvegicus) [TaxId:10116] [48944] (3 PDB entries)
  8. 8461Domain d1frtb1: 1frt B: [20666]
    Other proteins in same PDB: d1frta2, d1frtc1, d1frtc2

Details for d1frtb1

PDB Entry: 1frt (more details), 4.5 Å

PDB Description: crystal structure of the complex of rat neonatal fc receptor with fc

SCOP Domain Sequences for d1frtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frtb1 b.1.1.2 (B:) Fc (IgG) receptor, alpha-3 domain and beta subunit {Rat (Rattus norvegicus)}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1frtb1:

Click to download the PDB-style file with coordinates for d1frtb1.
(The format of our PDB-style files is described here.)

Timeline for d1frtb1: