Lineage for d2w6oc3 (2w6o C:331-446)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809035Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1809036Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 1809043Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1809046Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 1809095Domain d2w6oc3: 2w6o C:331-446 [206659]
    Other proteins in same PDB: d2w6oa1, d2w6oa2, d2w6oc1, d2w6oc2
    automated match to d1dv1a1
    complexed with cl, oa3

Details for d2w6oc3

PDB Entry: 2w6o (more details), 2.5 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment
PDB Compounds: (C:) biotin carboxylase

SCOPe Domain Sequences for d2w6oc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w6oc3 b.84.2.1 (C:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOPe Domain Coordinates for d2w6oc3:

Click to download the PDB-style file with coordinates for d2w6oc3.
(The format of our PDB-style files is described here.)

Timeline for d2w6oc3: