Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
Protein Biotin carboxylase (BC), domain 2 [56068] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [56069] (24 PDB entries) |
Domain d2w6nb2: 2w6n B:115-330 [206652] Other proteins in same PDB: d2w6na1, d2w6na3, d2w6nb1, d2w6nb3 automated match to d1dv1a3 complexed with cl, oa2 |
PDB Entry: 2w6n (more details), 1.87 Å
SCOPe Domain Sequences for d2w6nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w6nb2 d.142.1.2 (B:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq vehpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d2w6nb2: