Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [52443] (19 PDB entries) |
Domain d2w6nb1: 2w6n B:1-114 [206651] Other proteins in same PDB: d2w6na2, d2w6na3, d2w6nb2, d2w6nb3 automated match to d1dv1a2 complexed with cl, oa2 |
PDB Entry: 2w6n (more details), 1.87 Å
SCOPe Domain Sequences for d2w6nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w6nb1 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d2w6nb1: