Lineage for d2w6na2 (2w6n A:115-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978561Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2978564Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 2978567Domain d2w6na2: 2w6n A:115-330 [206649]
    Other proteins in same PDB: d2w6na1, d2w6na3, d2w6nb1, d2w6nb3
    automated match to d1dv1a3
    complexed with cl, oa2

Details for d2w6na2

PDB Entry: 2w6n (more details), 1.87 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with amino-oxazole fragment series
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2w6na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w6na2 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2w6na2:

Click to download the PDB-style file with coordinates for d2w6na2.
(The format of our PDB-style files is described here.)

Timeline for d2w6na2: