SCOPe 2.04: Domain d2w6ma3: 2w6m A:331-447

Lineage for d2w6ma3 (2w6m A:331-447)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)

8. Domain d2w6ma3: 2w6m A:331-447 [206644]
   Other proteins in same PDB: d2w6ma1, d2w6ma2, d2w6mb1, d2w6mb2
   automated match to d1dv1b1
   complexed with cl, oa1

Details for d2w6ma3

PDB Entry: 2w6m, 2 Å

PDB Description: crystal structure of biotin carboxylase from e. coli in complex with amino-oxazole fragment series

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2w6ma3:

Sequence; same for both SEQRES and ATOM records:

>d2w6ma3 b.84.2.1 (A:331-447) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

Timeline for d2w6ma3:

• d2w6ma3 first appeared in SCOPe 2.03
  
• d2w6ma3 appears in SCOPe 2.05
  
• d2w6ma3 appears in the current release, SCOPe 2.08