![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (3 proteins) Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain |
![]() | Protein Glucosaminidase GH84, catalytic domain [141790] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (10 PDB entries) Uniprot Q89ZI2 148-457 |
![]() | Domain d2w67b2: 2w67 B:127-436 [206640] Other proteins in same PDB: d2w67b1, d2w67b3 automated match to d2j47a2 complexed with ca, f34, gol |
PDB Entry: 2w67 (more details), 2.25 Å
SCOPe Domain Sequences for d2w67b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w67b2 c.1.8.10 (B:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns dlgpnghgyr
Timeline for d2w67b2: