![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
![]() | Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins) |
![]() | Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries) Uniprot Q89ZI2 25-147 |
![]() | Domain d2w67b1: 2w67 B:5-126 [206639] Other proteins in same PDB: d2w67b2, d2w67b3 automated match to d2j47a3 complexed with ca, f34, gol |
PDB Entry: 2w67 (more details), 2.25 Å
SCOPe Domain Sequences for d2w67b1:
Sequence, based on SEQRES records: (download)
>d2w67b1 d.92.2.3 (B:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy ps
>d2w67b1 d.92.2.3 (B:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps
Timeline for d2w67b1: